Lineage for d4tqba_ (4tqb A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1916685Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 1916686Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 1916687Family d.86.1.1: Translation initiation factor eIF4e [55419] (2 proteins)
    automatically mapped to Pfam PF01652
  6. 1916688Protein Translation initiation factor eIF4e [55420] (3 species)
    messenger RNA 5' cap-binding protein
  7. 1916692Species Human (Homo sapiens) [TaxId:9606] [160542] (13 PDB entries)
  8. 1916695Domain d4tqba_: 4tqb A: [267411]
    automated match to d1ipca_
    complexed with 34k, mes, mgt

Details for d4tqba_

PDB Entry: 4tqb (more details), 1.59 Å

PDB Description: The co-complex structure of the translation initiation factor eIF4E with the inhibitor 4EGI-1 reveals an allosteric mechanism for dissociating eIF4G
PDB Compounds: (A:) eukaryotic translation initiation factor 4e

SCOPe Domain Sequences for d4tqba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tqba_ d.86.1.1 (A:) Translation initiation factor eIF4e {Human (Homo sapiens) [TaxId: 9606]}
hyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdys
lfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvcga
vvnvrakgdkiaiwttecenreavthigrvykerlglppkivigyqshadtatksgsttk
nrfvv

SCOPe Domain Coordinates for d4tqba_:

Click to download the PDB-style file with coordinates for d4tqba_.
(The format of our PDB-style files is described here.)

Timeline for d4tqba_: