Lineage for d4rr3n_ (4rr3 N:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2075626Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2075627Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 protein domains)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 2075905Protein automated matches [190854] (15 species)
    not a true protein
  7. 2075942Species Human enterovirus 71 [TaxId:39054] [195913] (11 PDB entries)
  8. 2075954Domain d4rr3n_: 4rr3 N: [267409]
    automated match to d3vbhc_

Details for d4rr3n_

PDB Entry: 4rr3 (more details), 3.1 Å

PDB Description: crystal structure of a recombinant ev71 virus particle
PDB Compounds: (N:) capsid protein vp3

SCOPe Domain Sequences for d4rr3n_:

Sequence, based on SEQRES records: (download)

>d4rr3n_ b.121.4.1 (N:) automated matches {Human enterovirus 71 [TaxId: 39054]}
gfptelkpgtnqflttddgvsapilpnfhptpcihipgevrnllelcqvetilevnnvpt
natslmerlrfpvsaqagkgelcavfradpgrsgpwqstllgqlcgyytqwsgslevtfm
ftgsfmatgkmliaytppggplpkdratamlgthviwdfglqssvtlvipwisnthyrah
ardgvfdyyttglvsiwyqtnyvvpigapntayiialaaaqknftmqlckdasdilqtgt

Sequence, based on observed residues (ATOM records): (download)

>d4rr3n_ b.121.4.1 (N:) automated matches {Human enterovirus 71 [TaxId: 39054]}
gfptelkpgtnqflttddgvsapilpnfhptpcihipgevrnllelcqvetilevnnvpt
natslmerlrfpvsaqagkgelcavfradpgrsgpwqstllgqlcgyytqwsgslevtfm
ftgsfmatgkmliaytppggplpkdratamlgthviwdfglqssvtlvipwisnthyryt
tglvsiwyqtnyvvpigapntayiialaaaqknftmqlckdasdilqtgt

SCOPe Domain Coordinates for d4rr3n_:

Click to download the PDB-style file with coordinates for d4rr3n_.
(The format of our PDB-style files is described here.)

Timeline for d4rr3n_: