Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
Protein automated matches [190891] (32 species) not a true protein |
Species Staphylococcus aureus [TaxId:451516] [261285] (2 PDB entries) |
Domain d4rqaa_: 4rqa A: [267405] automated match to d3kb8b_ complexed with act, cl, gol, na |
PDB Entry: 4rqa (more details), 1.48 Å
SCOPe Domain Sequences for d4rqaa_:
Sequence, based on SEQRES records: (download)
>d4rqaa_ c.61.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 451516]} mnsvmhndlkevllteediqnickelgaqltkdyqgkplvcvgilkgsamfmsdlikrid thlsidfmdvssyhggtestgevqiikdlgssienkdvliiediletgttlksitellqs rkvnsleivtlldkpnrrkadieakyvgkkipdefvvgygldyrelyrnlpyigtlkpev y
>d4rqaa_ c.61.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 451516]} mnsvmhndlkevllteediqnickelgaqltkdyqgkplvcvgilkgsamfmsdlikrid thlsidfmdvssystgevqiikdlgssienkdvliiediletgttlksitellqsrkvns leivtlldkpnrrkadieakyvgkkipdefvvgygldyrelyrnlpyigtlkpevy
Timeline for d4rqaa_: