Lineage for d4rqaa_ (4rqa A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143900Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2143901Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2144416Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2144417Protein automated matches [190891] (32 species)
    not a true protein
  7. 2144616Species Staphylococcus aureus [TaxId:451516] [261285] (2 PDB entries)
  8. 2144617Domain d4rqaa_: 4rqa A: [267405]
    automated match to d3kb8b_
    complexed with act, cl, gol, na

Details for d4rqaa_

PDB Entry: 4rqa (more details), 1.48 Å

PDB Description: crystal structure of a hypoxanthine phosphoribosyltransferase (target id nysgrc-029686) from staphylococcus aureus (orthorhombic space group)
PDB Compounds: (A:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d4rqaa_:

Sequence, based on SEQRES records: (download)

>d4rqaa_ c.61.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 451516]}
mnsvmhndlkevllteediqnickelgaqltkdyqgkplvcvgilkgsamfmsdlikrid
thlsidfmdvssyhggtestgevqiikdlgssienkdvliiediletgttlksitellqs
rkvnsleivtlldkpnrrkadieakyvgkkipdefvvgygldyrelyrnlpyigtlkpev
y

Sequence, based on observed residues (ATOM records): (download)

>d4rqaa_ c.61.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 451516]}
mnsvmhndlkevllteediqnickelgaqltkdyqgkplvcvgilkgsamfmsdlikrid
thlsidfmdvssystgevqiikdlgssienkdvliiediletgttlksitellqsrkvns
leivtlldkpnrrkadieakyvgkkipdefvvgygldyrelyrnlpyigtlkpevy

SCOPe Domain Coordinates for d4rqaa_:

Click to download the PDB-style file with coordinates for d4rqaa_.
(The format of our PDB-style files is described here.)

Timeline for d4rqaa_: