Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (158 species) not a true protein |
Species Sphingobium chlorophenolicum [TaxId:46429] [261279] (3 PDB entries) |
Domain d4rpoc_: 4rpo C: [267403] automated match to d4rnsa_ complexed with dms, gol, t6c |
PDB Entry: 4rpo (more details), 1.95 Å
SCOPe Domain Sequences for d4rpoc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rpoc_ c.94.1.0 (C:) automated matches {Sphingobium chlorophenolicum [TaxId: 46429]} fdpgtsnrnfriaasdfgqalmlprlyatleetapqvrvtgvnlrhgplveelesgsidi afggfptlsagiktqtlfreeyvcvmrqshpalthgldleafrqcrhiivtahefnhvhe qvearllellppesirfttenflvsaviaeetdviltipsrlarwfanrggltifpvpie lpsievkqywherydkdpgniwlrrviakigfqnppa
Timeline for d4rpoc_: