Lineage for d4rpoc_ (4rpo C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916135Species Sphingobium chlorophenolicum [TaxId:46429] [261279] (3 PDB entries)
  8. 2916138Domain d4rpoc_: 4rpo C: [267403]
    automated match to d4rnsa_
    complexed with dms, gol, t6c

Details for d4rpoc_

PDB Entry: 4rpo (more details), 1.95 Å

PDB Description: PcpR inducer binding domain (Complex with 2,4,6-trichlorophenol)
PDB Compounds: (C:) PCP degradation transcriptional activation protein

SCOPe Domain Sequences for d4rpoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rpoc_ c.94.1.0 (C:) automated matches {Sphingobium chlorophenolicum [TaxId: 46429]}
fdpgtsnrnfriaasdfgqalmlprlyatleetapqvrvtgvnlrhgplveelesgsidi
afggfptlsagiktqtlfreeyvcvmrqshpalthgldleafrqcrhiivtahefnhvhe
qvearllellppesirfttenflvsaviaeetdviltipsrlarwfanrggltifpvpie
lpsievkqywherydkdpgniwlrrviakigfqnppa

SCOPe Domain Coordinates for d4rpoc_:

Click to download the PDB-style file with coordinates for d4rpoc_.
(The format of our PDB-style files is described here.)

Timeline for d4rpoc_: