SCOPe 2.08: Domain d4rkqd1: 4rkq D:70-341

Lineage for d4rkqd1 (4rkq D:70-341)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (77 species)
   not a true protein

7. Species Arthrobacter sp. [TaxId:290399] [260960] (2 PDB entries)

8. Domain d4rkqd1: 4rkq D:70-341 [267396]
   Other proteins in same PDB: d4rkqa2, d4rkqb2, d4rkqc2, d4rkqd2
   automated match to d4rkra_
   complexed with cl, edo, mg

Details for d4rkqd1

PDB Entry: 4rkq, 1.9 Å

PDB Description: crystal structure of laci family transcriptional regulator from arthrobacter sp. fb24, target efi-560007

PDB Compounds: (D:) Transcriptional regulator, LacI family

SCOPe Domain Sequences for d4rkqd1:

Sequence; same for both SEQRES and ATOM records:

>d4rkqd1 c.93.1.0 (D:70-341) automated matches {Arthrobacter sp. [TaxId: 290399]}
rtsvglaipdltnpyfpafassvvelatlrgwhvvvddyghggrsgldavehlapqvdav
igylggyadqaqtvlgrrplivldenpggaagsinfdyqhaakvavaqlmdskrqhiayl
eagsasesdepvpctvrgkavagrldelgaswslivaeetaeaareaaaaflrehpetdg
ilafndlmaagvlkalsgsgrrvpedcavigmdgiplgellspqlstmaldlrevgraav
ellvgllsgavtpgsqssrttlkhrlvlrest

Timeline for d4rkqd1:

• d4rkqd1 first appeared in SCOPe 2.05, called d4rkqd_
  
• d4rkqd1 appears in SCOPe 2.07