Lineage for d4rkqd1 (4rkq D:70-341)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2913229Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2913230Protein automated matches [190646] (77 species)
    not a true protein
  7. 2913283Species Arthrobacter sp. [TaxId:290399] [260960] (2 PDB entries)
  8. 2913287Domain d4rkqd1: 4rkq D:70-341 [267396]
    Other proteins in same PDB: d4rkqa2, d4rkqb2, d4rkqc2, d4rkqd2
    automated match to d4rkra_
    complexed with cl, edo, mg

Details for d4rkqd1

PDB Entry: 4rkq (more details), 1.9 Å

PDB Description: crystal structure of laci family transcriptional regulator from arthrobacter sp. fb24, target efi-560007
PDB Compounds: (D:) Transcriptional regulator, LacI family

SCOPe Domain Sequences for d4rkqd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rkqd1 c.93.1.0 (D:70-341) automated matches {Arthrobacter sp. [TaxId: 290399]}
rtsvglaipdltnpyfpafassvvelatlrgwhvvvddyghggrsgldavehlapqvdav
igylggyadqaqtvlgrrplivldenpggaagsinfdyqhaakvavaqlmdskrqhiayl
eagsasesdepvpctvrgkavagrldelgaswslivaeetaeaareaaaaflrehpetdg
ilafndlmaagvlkalsgsgrrvpedcavigmdgiplgellspqlstmaldlrevgraav
ellvgllsgavtpgsqssrttlkhrlvlrest

SCOPe Domain Coordinates for d4rkqd1:

Click to download the PDB-style file with coordinates for d4rkqd1.
(The format of our PDB-style files is described here.)

Timeline for d4rkqd1: