Lineage for d4rk7a_ (4rk7 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143989Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2143990Protein automated matches [190646] (70 species)
    not a true protein
  7. 2144284Species Weissella paramesenteroides [TaxId:585506] [260797] (2 PDB entries)
  8. 2144287Domain d4rk7a_: 4rk7 A: [267391]
    automated match to d4rk0d_
    complexed with suc

Details for d4rk7a_

PDB Entry: 4rk7 (more details), 1.8 Å

PDB Description: Crystal structure of LacI family transcriptional regulator CCPA from Weissella paramesenteroides, Target EFI-512926, with bound sucrose
PDB Compounds: (A:) Glucose-resistance amylase regulator

SCOPe Domain Sequences for d4rk7a_:

Sequence, based on SEQRES records: (download)

>d4rk7a_ c.93.1.0 (A:) automated matches {Weissella paramesenteroides [TaxId: 585506]}
rvvgvvvplihtnfadeiikglyettissgyellityldededhqyqvfqtllsrqvgav
fmlsldipswmidklleeqisvisltallseqisavtsnefemmnsivdylidmghknia
lvgdtklttnisstrrtnfiksmtdhnlayeniflygndhsyetgytsvttgydinqlpf
taaiatadmvgqglinamsdhgktvpedlsivtidglqqteiarpklttvkqdfpeigri
amqlfldsdsektepqiiyipteliqrdsvlnln

Sequence, based on observed residues (ATOM records): (download)

>d4rk7a_ c.93.1.0 (A:) automated matches {Weissella paramesenteroides [TaxId: 585506]}
rvvgvvvplihtnfadeiikglyettissgyellityldededhqyqvfqtllsrqvgav
fmlsldipswmidklleeqisvisltallseqisavtsnefemmnsivdylidmghknia
lvgdtklttnisstrrtnfiksmtdhnlayeniflygndhsyetgytsvttgydinqlpf
taaiatadmvgqglinamsdhgktvpedlsivtidglqqteiarpklttvkqdfpeigri
amqlfldsdepqiiyipteliqrdsvlnln

SCOPe Domain Coordinates for d4rk7a_:

Click to download the PDB-style file with coordinates for d4rk7a_.
(The format of our PDB-style files is described here.)

Timeline for d4rk7a_: