Lineage for d1jlda_ (1jld A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily) Superfamily b.50.1: Acid proteases [50630] (2 families) 
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins) 
Protein Human immunodeficiency virus type 2 (HIV-2) protease [50634] (1 species) Species Human immunodeficiency virus type 2 [TaxId:11709] [50635] (15 PDB entries) 
Domain d1jlda_: 1jld A: [26739]
Details for d1jlda_
PDB Entry: 1jld (more details), 2.5 Å
PDB Description: Potent hiv protease inhibitors containing a novel (hydroxyethyl)amide isostere
SCOP Domain Sequences for d1jlda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jlda_ b.50.1.1 (A:) Human immunodeficiency virus type 2 (HIV-2) protease {Human immunodeficiency virus type 2}
pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintkeyk
nveievlnkkvratimtgdtpinifgrniltalgmslnl
SCOP Domain Coordinates for d1jlda_:
Click to download the PDB-style file with coordinates for d1jlda_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jlda_:
- d1jlda_ appears in SCOP 1.57
- d1jlda_ appears in the current release, SCOPe 2.08
View in 3D
