Lineage for d4rjya_ (4rjy A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2504746Species Escherichia coli [TaxId:1182686] [267992] (1 PDB entry)
  8. 2504747Domain d4rjya_: 4rjy A: [267387]
    automated match to d3wgba_
    complexed with na, ser

Details for d4rjya_

PDB Entry: 4rjy (more details), 2.1 Å

PDB Description: Crystal structure of E. coli L-Threonine Aldolase in complex with a non-covalently uncleaved bound L-serine substrate
PDB Compounds: (A:) Low specificity L-threonine aldolase

SCOPe Domain Sequences for d4rjya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rjya_ c.67.1.0 (A:) automated matches {Escherichia coli [TaxId: 1182686]}
midlrsdtvtrpsramleammaapvgddvygddptvnalqdyaaelsgkeaaiflptgtq
anlvallshcergeeyivgqaahnylfeaggaavlgsiqpqpidaaadgtlpldkvamki
kpddihfartkllslenthngkvlpreylkeaweftrkrnlalhvdgarifnavvaygce
lkeitqycdsfticlskglgtpvgsllvgnrdyikrairwrkmtgggmrqsgilaaagmy
alknnvarlqedhdntawmaeqlreagadvmrqdtnmlfvrvgeenaaalgeymkarnvl
inaspivrlvthldvsraqlaevaahwrafla

SCOPe Domain Coordinates for d4rjya_:

Click to download the PDB-style file with coordinates for d4rjya_.
(The format of our PDB-style files is described here.)

Timeline for d4rjya_: