Lineage for d4r8ra_ (4r8r A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2894559Species Dengue virus 3 [TaxId:11069] [260424] (4 PDB entries)
  8. 2894560Domain d4r8ra_: 4r8r A: [267379]
    automated match to d2oxta_

Details for d4r8ra_

PDB Entry: 4r8r (more details), 1.46 Å

PDB Description: Dengue virus serotype 3 methyltransferase without a bound S-adenosyl methionine
PDB Compounds: (A:) nonstructural protein ns5

SCOPe Domain Sequences for d4r8ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r8ra_ c.66.1.0 (A:) automated matches {Dengue virus 3 [TaxId: 11069]}
etlgekwkkklnqlsrkefdlykksgitevdrteakeglkrgetthhavsrgsaklqwfv
ernmvipegrvidlgcgrggwsyycaglkkvtevrgytkggpgheepvpmstygwnivkl
msgkdvfylppekcdtllcdigesspsptveesrtirvlkmvepwlknnqfcikvlnpym
ptviehlerlqrkhggmlvrnplsrnsthemywisngtgnivssvnmvsrlllnrftmth
rrptiekdvdlgagtr

SCOPe Domain Coordinates for d4r8ra_:

Click to download the PDB-style file with coordinates for d4r8ra_.
(The format of our PDB-style files is described here.)

Timeline for d4r8ra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4r8rb_