Lineage for d4r6ha_ (4r6h A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1880254Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1880255Protein automated matches [190039] (120 species)
    not a true protein
  7. 1880320Species Bacillus subtilis [TaxId:224308] [194551] (3 PDB entries)
  8. 1880321Domain d4r6ha_: 4r6h A: [267378]
    automated match to d4rk9a_
    complexed with cl

Details for d4r6ha_

PDB Entry: 4r6h (more details), 1.5 Å

PDB Description: Crystal structure of putative binding protein msme from bacillus subtilis subsp. subtilis str. 168, target efi-510764, an open conformation
PDB Compounds: (A:) Solute binding protein MsmE

SCOPe Domain Sequences for d4r6ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r6ha_ c.94.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
adtakktltiystmstdserdtfrklaaafekehsdihvslhfpgndyenmmrvrmaand
lpdlfdthgwgkirygeytadlrdmkwtqdldpnlnsilknksgkvyaypinqakdglay
nrnildrygiappetmddfikalrtikekskgsivpfwfagydkssfaqyydqfatplli
tdpahnekkqlingtfqwskftylseilkqmqkeklinidavtakksqlielmaqnkiaf
tmqggtlgqdvaqinpnvkvgiiptpaihpgddpiwiggerytlaawkdspqlkeakdfi
afmarpanakqmaeatslpsgltnvkadifyandyeyyqdvkvepyfdrlylpngmwdvl
gtvgqelaadilapqdisqklgreykrlreqset

SCOPe Domain Coordinates for d4r6ha_:

Click to download the PDB-style file with coordinates for d4r6ha_.
(The format of our PDB-style files is described here.)

Timeline for d4r6ha_: