SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4r4ca1 (4r4c A:1-120)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2051128Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2051200Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 protein domains)
    barrel, closed; n=5, S=10
  6. 2051392Protein automated matches [190206] (8 species)
    not a true protein
  7. 2051402Species Human (Homo sapiens) [TaxId:9606] [186959] (25 PDB entries)
  8. 2051417Domain d4r4ca1: 4r4c A:1-120 [267374]
    Other proteins in same PDB: d4r4ca2
    automated match to d4ipca_
    complexed with 3hs

Details for d4r4ca1

PDB Entry: 4r4c (more details), 1.4 Å

PDB Description: structure of rpa70n in complex with 5-(4-((4-(5-carboxyfuran-2-yl)-2- chlorobenzamido)methyl)phenyl)-1-(3,4-dichlorophenyl)-1h-pyrazole-3- carboxylic acid
PDB Compounds: (A:) Replication protein A 70 kDa DNA-binding subunit

SCOPe Domain Sequences for d4r4ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r4ca1 b.40.4.3 (A:1-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvgqlsrgaiaaimqkgdtnikpilqvinirpittgnsppryrllmsdglntlssfmlat
qlnplveeeqlssncvcqihrfivntlkdgrrvvilmelevlksaeavgvkignpvpyne

SCOPe Domain Coordinates for d4r4ca1:

Click to download the PDB-style file with coordinates for d4r4ca1.
(The format of our PDB-style files is described here.)

Timeline for d4r4ca1:

  • d4r4ca1 first appeared in SCOPe 2.05, called d4r4ca_

View in 3D
Domains from same chain:
(mouse over for more information)
d4r4ca2