Lineage for d4r4ca1 (4r4c A:1-120)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789342Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
    barrel, closed; n=5, S=10
  6. 2789537Protein automated matches [190206] (10 species)
    not a true protein
  7. 2789550Species Human (Homo sapiens) [TaxId:9606] [186959] (27 PDB entries)
  8. 2789567Domain d4r4ca1: 4r4c A:1-120 [267374]
    Other proteins in same PDB: d4r4ca2
    automated match to d4ipca_
    complexed with 3hs

Details for d4r4ca1

PDB Entry: 4r4c (more details), 1.4 Å

PDB Description: structure of rpa70n in complex with 5-(4-((4-(5-carboxyfuran-2-yl)-2- chlorobenzamido)methyl)phenyl)-1-(3,4-dichlorophenyl)-1h-pyrazole-3- carboxylic acid
PDB Compounds: (A:) Replication protein A 70 kDa DNA-binding subunit

SCOPe Domain Sequences for d4r4ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r4ca1 b.40.4.3 (A:1-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvgqlsrgaiaaimqkgdtnikpilqvinirpittgnsppryrllmsdglntlssfmlat
qlnplveeeqlssncvcqihrfivntlkdgrrvvilmelevlksaeavgvkignpvpyne

SCOPe Domain Coordinates for d4r4ca1:

Click to download the PDB-style file with coordinates for d4r4ca1.
(The format of our PDB-style files is described here.)

Timeline for d4r4ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4r4ca2