SCOP 1.61: Domain d1hsia_: 1hsi A:

Lineage for d1hsia_ (1hsi A:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)

6. Protein Human immunodeficiency virus type 2 (HIV-2) protease [50634] (1 species)

7. Species Human immunodeficiency virus type 2 [TaxId:11709] [50635] (15 PDB entries)

8. Domain d1hsia_: 1hsi A: [26737]

Details for d1hsia_

PDB Entry: 1hsi, 2.5 Å

PDB Description: crystal structure at 1.9 angstroms resolution of human immunodeficiency virus (hiv) ii protease complexed with l-735,524, an orally bioavailable inhibitor of the hiv proteases

SCOP Domain Sequences for d1hsia_:

Sequence; same for both SEQRES and ATOM records:

>d1hsia_ b.50.1.1 (A:) Human immunodeficiency virus type 2 (HIV-2) protease {Human immunodeficiency virus type 2}
pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintkeyk
nveievlnkkvratimtgdtpinifgrniltalgmslnl

Timeline for d1hsia_:

• d1hsia_ first appeared (with stable ids) in SCOP 1.55
  
• d1hsia_ appears in SCOP 1.59
  
• d1hsia_ appears in SCOP 1.63
  
• d1hsia_ appears in the current release, SCOPe 2.08