Class b: All beta proteins [48724] (176 folds) |
Fold b.77: beta-Prism I [51091] (3 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
Superfamily b.77.2: delta-Endotoxin (insectocide), middle domain [51096] (2 families) |
Family b.77.2.0: automated matches [254290] (1 protein) not a true family |
Protein automated matches [254673] (3 species) not a true protein |
Species Bacillus thuringiensis [TaxId:1444] [258996] (4 PDB entries) |
Domain d4qx1a2: 4qx1 A:290-499 [267368] Other proteins in same PDB: d4qx1a1, d4qx1a3 automated match to d1dlca2 |
PDB Entry: 4qx1 (more details), 2.8 Å
SCOPe Domain Sequences for d4qx1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qx1a2 b.77.2.0 (A:290-499) automated matches {Bacillus thuringiensis [TaxId: 1444]} lypkevkteltrdvltdpivgvnnlrgygttfsnienyirkphlfdylhriqfhtrfqpg yygndsfnywsgnyvstrpsigsndiitspfygnkssepvqnlefngekvyravantnla vwpsavysgvtkvefsqyndqtdeastqtydskrnvgavswdsidqlppettdeplekgy shqlnyvmcflmqgsrgtipvltwthksvd
Timeline for d4qx1a2: