Lineage for d4qx1a1 (4qx1 A:61-289)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2250850Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2250891Superfamily f.1.3: delta-Endotoxin (insectocide), N-terminal domain [56849] (2 families) (S)
    automatically mapped to Pfam PF03945
  5. 2250892Family f.1.3.1: delta-Endotoxin (insectocide), N-terminal domain [56850] (2 proteins)
    seven-helical bundle with central helix surrounded by six others
  6. 2250904Protein automated matches [254738] (2 species)
    not a true protein
  7. 2250905Species Bacillus thuringiensis [TaxId:1444] [258994] (4 PDB entries)
  8. 2250907Domain d4qx1a1: 4qx1 A:61-289 [267367]
    Other proteins in same PDB: d4qx1a2, d4qx1a3
    automated match to d1dlca3

Details for d4qx1a1

PDB Entry: 4qx1 (more details), 2.8 Å

PDB Description: cry3a toxin structure obtained by serial femtosecond crystallography from in vivo grown crystals isolated from bacillus thuringiensis and data processed with the crystfel software suite
PDB Compounds: (A:) Pesticidal crystal protein cry3Aa

SCOPe Domain Sequences for d4qx1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qx1a1 f.1.3.1 (A:61-289) automated matches {Bacillus thuringiensis [TaxId: 1444]}
ttkdviqkgisvvgdllgvvgfpfggalvsfytnflntiwpsedpwkafmeqvealmdqk
iadyaknkalaelqglqnnvedyvsalsswqknpvssrnphsqgrirelfsqaeshfrns
mpsfaisgyevlflttyaqaanthlfllkdaqiygeewgyekediaefykrqlkltqeyt
dhcvkwynvgldklrgssyeswvnfnryrremtltvldlialfplydvr

SCOPe Domain Coordinates for d4qx1a1:

Click to download the PDB-style file with coordinates for d4qx1a1.
(The format of our PDB-style files is described here.)

Timeline for d4qx1a1: