Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.3: delta-Endotoxin (insectocide), N-terminal domain [56849] (2 families) automatically mapped to Pfam PF03945 |
Family f.1.3.1: delta-Endotoxin (insectocide), N-terminal domain [56850] (2 proteins) seven-helical bundle with central helix surrounded by six others |
Protein automated matches [254738] (2 species) not a true protein |
Species Bacillus thuringiensis [TaxId:1444] [258994] (4 PDB entries) |
Domain d4qx1a1: 4qx1 A:61-289 [267367] Other proteins in same PDB: d4qx1a2, d4qx1a3 automated match to d1dlca3 |
PDB Entry: 4qx1 (more details), 2.8 Å
SCOPe Domain Sequences for d4qx1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qx1a1 f.1.3.1 (A:61-289) automated matches {Bacillus thuringiensis [TaxId: 1444]} ttkdviqkgisvvgdllgvvgfpfggalvsfytnflntiwpsedpwkafmeqvealmdqk iadyaknkalaelqglqnnvedyvsalsswqknpvssrnphsqgrirelfsqaeshfrns mpsfaisgyevlflttyaqaanthlfllkdaqiygeewgyekediaefykrqlkltqeyt dhcvkwynvgldklrgssyeswvnfnryrremtltvldlialfplydvr
Timeline for d4qx1a1: