SCOP 1.65: Domain d3upja_: 3upj A:

Lineage for d3upja_ (3upj A:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 2 (HIV-2) protease [50634] (1 species)

7. Species Human immunodeficiency virus type 2 [TaxId:11709] [50635] (15 PDB entries)

8. Domain d3upja_: 3upj A: [26735]

Details for d3upja_

PDB Entry: 3upj, 2.5 Å

PDB Description: human immunodeficiency virus type 2 protease mutant with lys 57 replaced by leu (k57l) complex with u096333 [4-hydroxy-3-[1-(phenyl) propyl]-7-methoxycoumarin]

SCOP Domain Sequences for d3upja_:

Sequence; same for both SEQRES and ATOM records:

>d3upja_ b.50.1.1 (A:) Human immunodeficiency virus type 2 (HIV-2) protease {Human immunodeficiency virus type 2}
pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintleyk
nveievlnkkvratimtgdtpinifgrniltalgmslnl

Timeline for d3upja_:

• d3upja_ first appeared (with stable ids) in SCOP 1.55
  
• d3upja_ appears in SCOP 1.63
  
• d3upja_ appears in SCOP 1.67
  
• d3upja_ appears in the current release, SCOPe 2.08