Lineage for d4qs6b_ (4qs6 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096081Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2096704Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 2096705Protein automated matches [190150] (26 species)
    not a true protein
  7. 2096818Species Novosphingobium aromaticivorans [TaxId:279238] [267952] (6 PDB entries)
  8. 2096830Domain d4qs6b_: 4qs6 B: [267347]
    automated match to d3s4ta_
    complexed with 1df, cl, gol; mutant

Details for d4qs6b_

PDB Entry: 4qs6 (more details), 1.76 Å

PDB Description: crystal structure of 5-carboxyvanillate decarboxylase ligw2 from novosphingobium aromaticivorans dsm 12444 (target efi-505250) with bound 4-hydroxy-3-methoxy-5-nitrobenzoic acid, no metal, the d314n mutant
PDB Compounds: (B:) Ligw2 Decarboxylase

SCOPe Domain Sequences for d4qs6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qs6b_ c.1.9.0 (B:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}
qdlktggeqgylriateeafatreiidvylrmirdgtadkgmvslwgfyaqspseratqi
lerlldlgerriadmdatgidkailaltspgvqplhdldeartlatrandtladacqkyp
drfigmgtvapqdpewsareihrgarelgfkgiqinshtqgryldeeffdpifralvevd
qplyihpatspdsmidpmleagldgaifgfgvetgmhllrlitigifdkypslqimvghm
gealpywlyrldymhqagvrsqryermkplkktiegylksnvlvtnsgvawepaikfcqq
vmgedrvmyamnypyqyvadevramdamdmsaqtkkkffqtnaekwfkl

SCOPe Domain Coordinates for d4qs6b_:

Click to download the PDB-style file with coordinates for d4qs6b_.
(The format of our PDB-style files is described here.)

Timeline for d4qs6b_: