SCOP 1.65: Domain d2mipd_: 2mip D:

Lineage for d2mipd_ (2mip D:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 2 (HIV-2) protease [50634] (1 species)

7. Species Human immunodeficiency virus type 2 [TaxId:11709] [50635] (15 PDB entries)

8. Domain d2mipd_: 2mip D: [26734]
   complexed with nh2

Details for d2mipd_

PDB Entry: 2mip, 2.2 Å

PDB Description: crystal structure of human immunodeficiency virus (hiv) type 2 protease in complex with a reduced amide inhibitor and comparison with hiv-1 protease structures

SCOP Domain Sequences for d2mipd_:

Sequence; same for both SEQRES and ATOM records:

>d2mipd_ b.50.1.1 (D:) Human immunodeficiency virus type 2 (HIV-2) protease {Human immunodeficiency virus type 2}
pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintkeyk
nveievlnkkvratimtgdtpinifgrniltalgmslnl

Timeline for d2mipd_:

• d2mipd_ first appeared (with stable ids) in SCOP 1.55
  
• d2mipd_ appears in SCOP 1.63
  
• d2mipd_ appears in SCOP 1.67
  
• d2mipd_ appears in the current release, SCOPe 2.08