Lineage for d4qr1b_ (4qr1 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2562976Superfamily d.58.58: CRISPR associated protein Cas2-like [143430] (2 families) (S)
    contains extra C-terminal beta-strand that integrates into the beta-sheet of the other subunit in the homodimer, a probable biological unit of this superfamily
  5. 2563002Family d.58.58.0: automated matches [191564] (1 protein)
    not a true family
  6. 2563003Protein automated matches [190980] (6 species)
    not a true protein
  7. 2563014Species Streptococcus pyogenes [TaxId:301447] [261263] (3 PDB entries)
  8. 2563018Domain d4qr1b_: 4qr1 B: [267333]
    automated match to d4qr0a_

Details for d4qr1b_

PDB Entry: 4qr1 (more details), 2.19 Å

PDB Description: Crystal structure of Streptococcus pyogenes Cas2 at pH 6.5
PDB Compounds: (B:) CRISPR-associated endoribonuclease Cas2

SCOPe Domain Sequences for d4qr1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qr1b_ d.58.58.0 (B:) automated matches {Streptococcus pyogenes [TaxId: 301447]}
mmvlvtydvntetpagrkrlrhvaklcvdygqrvqnsvfecsvtpaefvdikhrltqiid
ektdsirfyllgknwqrrvetl

SCOPe Domain Coordinates for d4qr1b_:

Click to download the PDB-style file with coordinates for d4qr1b_.
(The format of our PDB-style files is described here.)

Timeline for d4qr1b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4qr1a_