| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.58: CRISPR associated protein Cas2-like [143430] (2 families) ![]() contains extra C-terminal beta-strand that integrates into the beta-sheet of the other subunit in the homodimer, a probable biological unit of this superfamily |
| Family d.58.58.0: automated matches [191564] (1 protein) not a true family |
| Protein automated matches [190980] (6 species) not a true protein |
| Species Streptococcus pyogenes [TaxId:301447] [261263] (3 PDB entries) |
| Domain d4qr1b_: 4qr1 B: [267333] automated match to d4qr0a_ |
PDB Entry: 4qr1 (more details), 2.19 Å
SCOPe Domain Sequences for d4qr1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qr1b_ d.58.58.0 (B:) automated matches {Streptococcus pyogenes [TaxId: 301447]}
mmvlvtydvntetpagrkrlrhvaklcvdygqrvqnsvfecsvtpaefvdikhrltqiid
ektdsirfyllgknwqrrvetl
Timeline for d4qr1b_: