SCOPe 2.07: Domain d4qr1a_: 4qr1 A:

Lineage for d4qr1a_ (4qr1 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.58: CRISPR associated protein Cas2-like [143430] (2 families)
   contains extra C-terminal beta-strand that integrates into the beta-sheet of the other subunit in the homodimer, a probable biological unit of this superfamily

5. Family d.58.58.0: automated matches [191564] (1 protein)
   not a true family

6. Protein automated matches [190980] (6 species)
   not a true protein

7. Species Streptococcus pyogenes [TaxId:301447] [261263] (3 PDB entries)

8. Domain d4qr1a_: 4qr1 A: [267332]
   automated match to d4qr0a_

Details for d4qr1a_

PDB Entry: 4qr1, 2.19 Å

PDB Description: Crystal structure of Streptococcus pyogenes Cas2 at pH 6.5

PDB Compounds: (A:) CRISPR-associated endoribonuclease Cas2

SCOPe Domain Sequences for d4qr1a_:

Sequence; same for both SEQRES and ATOM records:

>d4qr1a_ d.58.58.0 (A:) automated matches {Streptococcus pyogenes [TaxId: 301447]}
mmvlvtydvntetpagrkrlrhvaklcvdygqrvqnsvfecsvtpaefvdikhrltqiid
ektdsirfyllgknwqrrvetlg

Timeline for d4qr1a_:

• d4qr1a_ first appeared in SCOPe 2.05
  
• d4qr1a_ appears in SCOPe 2.06
  
• d4qr1a_ appears in the current release, SCOPe 2.08