![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (27 families) ![]() |
![]() | Family a.118.1.27: Aminopeptidase N (APN) C-terminal-like [254179] (1 protein) PubMed 17876832; C-terminal part of Pfam PF11940 this is a repeat family; one repeat unit is 4pvb A:690-721 found in domain |
![]() | Protein Aminopeptidase N (APN) C-terminal domain [254402] (1 species) |
![]() | Species Neisseria meningitidis [TaxId:122586] [254838] (9 PDB entries) |
![]() | Domain d4qpea4: 4qpe A:540-867 [267331] Other proteins in same PDB: d4qpea1, d4qpea2, d4qpea3 automated match to d2gtqa4 complexed with 37e, so4, zn |
PDB Entry: 4qpe (more details), 2 Å
SCOPe Domain Sequences for d4qpea4:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qpea4 a.118.1.27 (A:540-867) Aminopeptidase N (APN) C-terminal domain {Neisseria meningitidis [TaxId: 122586]} pysdddlllllahdsdaftrweaaqtlyrravaanlatlsdgvelpkhekllaavekvis ddlldnafkalllgvpseaelwdgaenidplryhqarealldtlavhflpkwhelnrqaa kqenqsyeyspeaagwrtlrnvcrafvlradpahietvaekygemaqnmthewgilsavn gnesdtrnrllaqfadkfsddalvmdkyfalvgssrrsdtlqqvrtalqhpkfslenpnk arsligsfsrnvphfhaedgsgyrfiadkvieidrfnpqvaarlvqafnlcnklephrkn lvkqalqriraqeglskdvgeivgkild
Timeline for d4qpea4: