Lineage for d4qpea3 (4qpe A:439-539)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2040155Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 2040156Family b.1.30.1: Zn aminopeptidase insert domain [254169] (3 proteins)
  6. 2040157Protein Aminopeptidase N (APN) domain 3 [254401] (1 species)
    PubMed 17876832; N-terminal part of Pfam PF11940
  7. 2040158Species Neisseria meningitidis [TaxId:122586] [254837] (9 PDB entries)
  8. 2040164Domain d4qpea3: 4qpe A:439-539 [267330]
    Other proteins in same PDB: d4qpea1, d4qpea2, d4qpea4
    automated match to d4qmea3
    complexed with 37e, so4, zn

Details for d4qpea3

PDB Entry: 4qpe (more details), 2 Å

PDB Description: crystal structure of aminopeptidase n in complex with n-cyclohexyl-1, 2-diaminoethylphosphonic acid
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4qpea3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qpea3 b.1.30.1 (A:439-539) Aminopeptidase N (APN) domain 3 {Neisseria meningitidis [TaxId: 122586]}
agtpvleaegrlknnifeltvkqtvpptpdmtdkqpmmipvkvgllnrngeavafdyqgk
rateavlllteaeqtfllegvteavvpsllrgfsapvhlny

SCOPe Domain Coordinates for d4qpea3:

Click to download the PDB-style file with coordinates for d4qpea3.
(The format of our PDB-style files is described here.)

Timeline for d4qpea3: