![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily) duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain |
![]() | Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) ![]() |
![]() | Family b.98.1.1: Zn aminopeptidase N-terminal domain [63738] (4 proteins) |
![]() | Protein Aminopeptidase N (APN) N-terminal domain [254399] (1 species) |
![]() | Species Neisseria meningitidis [TaxId:122586] [254835] (9 PDB entries) |
![]() | Domain d4qpea1: 4qpe A:1-188 [267328] Other proteins in same PDB: d4qpea2, d4qpea3, d4qpea4 automated match to d4qira1 complexed with 37e, so4, zn |
PDB Entry: 4qpe (more details), 2 Å
SCOPe Domain Sequences for d4qpea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qpea1 b.98.1.1 (A:1-188) Aminopeptidase N (APN) N-terminal domain {Neisseria meningitidis [TaxId: 122586]} msktvhylkdyqtpayhilktdlhfdinepqtvvksrltvepqrvgeplvldgsakllsv kingaaadyvlegetltiagvpserftveveteilpaenkslmglyasggnlftqcepeg frkitfyidrpdvmskftttivadkkrypvllsngnkidggefsdgrhwvkwedpfskps ylfalvag
Timeline for d4qpea1: