Lineage for d4qpea1 (4qpe A:1-188)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820567Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2820568Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2820569Family b.98.1.1: Zn aminopeptidase N-terminal domain [63738] (4 proteins)
  6. 2820570Protein Aminopeptidase N (APN) N-terminal domain [254399] (1 species)
  7. 2820571Species Neisseria meningitidis [TaxId:122586] [254835] (9 PDB entries)
  8. 2820578Domain d4qpea1: 4qpe A:1-188 [267328]
    Other proteins in same PDB: d4qpea2, d4qpea3, d4qpea4
    automated match to d4qira1
    complexed with 37e, so4, zn

Details for d4qpea1

PDB Entry: 4qpe (more details), 2 Å

PDB Description: crystal structure of aminopeptidase n in complex with n-cyclohexyl-1, 2-diaminoethylphosphonic acid
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4qpea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qpea1 b.98.1.1 (A:1-188) Aminopeptidase N (APN) N-terminal domain {Neisseria meningitidis [TaxId: 122586]}
msktvhylkdyqtpayhilktdlhfdinepqtvvksrltvepqrvgeplvldgsakllsv
kingaaadyvlegetltiagvpserftveveteilpaenkslmglyasggnlftqcepeg
frkitfyidrpdvmskftttivadkkrypvllsngnkidggefsdgrhwvkwedpfskps
ylfalvag

SCOPe Domain Coordinates for d4qpea1:

Click to download the PDB-style file with coordinates for d4qpea1.
(The format of our PDB-style files is described here.)

Timeline for d4qpea1: