SCOPe 2.06: Domain d4qghb_: 4qgh B:

Lineage for d4qghb_ (4qgh B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:282458] [193407] (7 PDB entries)

8. Domain d4qghb_: 4qgh B: [267313]
   automated match to d2ccgb_
   complexed with 32e

Details for d4qghb_

PDB Entry: 4qgh, 1.78 Å

PDB Description: S.aureus TMK in complex with potent inhibitor compound 47

PDB Compounds: (B:) thymidylate kinase

SCOPe Domain Sequences for d4qghb_:

Sequence, based on SEQRES records:

>d4qghb_ c.37.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 282458]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqrfksv
nadqplenvvedtyqtiikyleki

Sequence, based on observed residues (ATOM records):

>d4qghb_ c.37.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 282458]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriikrldqedlkfhekviegyqeiihnesqrfksvnadqpl
envvedtyqtiikyleki

Timeline for d4qghb_:

• d4qghb_ first appeared in SCOPe 2.05
  
• d4qghb_ appears in SCOPe 2.07
  
• d4qghb_ appears in the current release, SCOPe 2.08