Lineage for d2mipa_ (2mip A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15694Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 15695Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 15696Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)
  6. 15928Protein Human immunodeficiency virus type 2 (HIV-2) protease [50634] (1 species)
  7. 15929Species Human immunodeficiency virus type 2 [TaxId:11709] [50635] (15 PDB entries)
  8. 15946Domain d2mipa_: 2mip A: [26731]

Details for d2mipa_

PDB Entry: 2mip (more details), 2.2 Å

PDB Description: crystal structure of human immunodeficiency virus (hiv) type 2 protease in complex with a reduced amide inhibitor and comparison with hiv-1 protease structures

SCOP Domain Sequences for d2mipa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mipa_ b.50.1.1 (A:) Human immunodeficiency virus type 2 (HIV-2) protease {Human immunodeficiency virus type 2}
pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintkeyk
nveievlnkkvratimtgdtpinifgrniltalgmslnl

SCOP Domain Coordinates for d2mipa_:

Click to download the PDB-style file with coordinates for d2mipa_.
(The format of our PDB-style files is described here.)

Timeline for d2mipa_: