SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2mipa_ (2mip A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2058816Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 protein domains)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2059984Protein Human immunodeficiency virus type 2 (HIV-2) protease [50634] (2 species)
  7. 2059992Species Human immunodeficiency virus type 2 [TaxId:11709] [50635] (15 PDB entries)
  8. 2060011Domain d2mipa_: 2mip A: [26731]

Details for d2mipa_

PDB Entry: 2mip (more details), 2.2 Å

PDB Description: crystal structure of human immunodeficiency virus (hiv) type 2 protease in complex with a reduced amide inhibitor and comparison with hiv-1 protease structures
PDB Compounds: (A:) hiv-2 protease

SCOPe Domain Sequences for d2mipa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mipa_ b.50.1.1 (A:) Human immunodeficiency virus type 2 (HIV-2) protease {Human immunodeficiency virus type 2 [TaxId: 11709]}
pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintkeyk
nveievlnkkvratimtgdtpinifgrniltalgmslnl

SCOPe Domain Coordinates for d2mipa_:

Click to download the PDB-style file with coordinates for d2mipa_.
(The format of our PDB-style files is described here.)

Timeline for d2mipa_: