Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (130 species) not a true protein |
Species Staphylococcus aureus [TaxId:282458] [193407] (7 PDB entries) |
Domain d4qgaa_: 4qga A: [267308] automated match to d2ccgb_ complexed with 31z |
PDB Entry: 4qga (more details), 1.94 Å
SCOPe Domain Sequences for d4qgaa_:
Sequence, based on SEQRES records: (download)
>d4qgaa_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 282458]} safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqrfksv nadqplenvvedtyqtiikylek
>d4qgaa_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 282458]} safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain glypdltiylnvsaevgreriikndqedlkfhekviegyqeiihnesqrfksvnadqple nvvedtyqtiikylek
Timeline for d4qgaa_: