SCOPe 2.06: Domain d4qgaa_: 4qga A:

Lineage for d4qgaa_ (4qga A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:282458] [193407] (7 PDB entries)

8. Domain d4qgaa_: 4qga A: [267308]
   automated match to d2ccgb_
   complexed with 31z

Details for d4qgaa_

PDB Entry: 4qga, 1.94 Å

PDB Description: s.aureus tmk in complex with potent inhibitor compound 19, 2-(3- chlorophenoxy)-3-fluoro-4-{[(3s)-3-(5-methyl-2,4-dioxo-3,4- dihydropyrimidin-1(2h)-yl)piperidin-1-yl]methyl}benzoic acid

PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d4qgaa_:

Sequence, based on SEQRES records:

>d4qgaa_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 282458]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqrfksv
nadqplenvvedtyqtiikylek

Sequence, based on observed residues (ATOM records):

>d4qgaa_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 282458]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriikndqedlkfhekviegyqeiihnesqrfksvnadqple
nvvedtyqtiikylek

Timeline for d4qgaa_:

• d4qgaa_ first appeared in SCOPe 2.05
  
• d4qgaa_ appears in SCOPe 2.07
  
• d4qgaa_ appears in the current release, SCOPe 2.08