Lineage for d4qfia_ (4qfi A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928015Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2928016Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2928017Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2928489Protein automated matches [190061] (7 species)
    not a true protein
  7. 2928637Species Norway rat (Rattus norvegicus) [TaxId:10116] [259282] (2 PDB entries)
  8. 2928638Domain d4qfia_: 4qfi A: [267306]
    automated match to d4qfja_
    complexed with acy, zn

Details for d4qfia_

PDB Entry: 4qfi (more details), 1.78 Å

PDB Description: The crystal structure of rat angiogenin-heparin complex
PDB Compounds: (A:) angiogenin

SCOPe Domain Sequences for d4qfia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qfia_ d.5.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dprytkfltqhydakpkgrdarycesmmrrrgltspckevntfihgnkgsikaicgangs
pygenlrisqspfqittckhtggsprppcryrasagfrhvviacenglpvhfdesf

SCOPe Domain Coordinates for d4qfia_:

Click to download the PDB-style file with coordinates for d4qfia_.
(The format of our PDB-style files is described here.)

Timeline for d4qfia_: