Lineage for d4qc3a1 (4qc3 A:2062-2166)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 2706959Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)
  8. 2707469Domain d4qc3a1: 4qc3 A:2062-2166 [267301]
    Other proteins in same PDB: d4qc3a2, d4qc3b2
    automated match to d2e7oa_
    complexed with edo

Details for d4qc3a1

PDB Entry: 4qc3 (more details), 1.6 Å

PDB Description: crystal structure of human baz2b bromodomain in complex with a diacetylated histone 4 peptide (h4k8ack12ac)
PDB Compounds: (A:) Bromodomain adjacent to zinc finger domain protein 2B

SCOPe Domain Sequences for d4qc3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qc3a1 a.29.2.0 (A:2062-2166) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstireklssgqypn
letfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfk

SCOPe Domain Coordinates for d4qc3a1:

Click to download the PDB-style file with coordinates for d4qc3a1.
(The format of our PDB-style files is described here.)

Timeline for d4qc3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4qc3a2