Class b: All beta proteins [48724] (177 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins) automatically mapped to Pfam PF02931 |
Protein automated matches [190922] (2 species) not a true protein |
Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (31 PDB entries) |
Domain d4qabd1: 4qab D:1-205 [267294] Other proteins in same PDB: d4qaba2, d4qabb2, d4qabc2, d4qabd2, d4qabe2, d4qabf2, d4qabg2, d4qabh2, d4qabi2, d4qabj2 automated match to d4alxa_ complexed with kk2, nag, po4 |
PDB Entry: 4qab (more details), 2.98 Å
SCOPe Domain Sequences for d4qabd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qabd1 b.96.1.1 (D:1-205) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk nsvtysccpeayedvevslnfrkkg
Timeline for d4qabd1: