SCOPe 2.06: Domain d4qabb1: 4qab B:1-205

Lineage for d4qabb1 (4qab B:1-205)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
   automatically mapped to Pfam PF02931

6. Protein automated matches [190922] (2 species)
   not a true protein

7. Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (31 PDB entries)

8. Domain d4qabb1: 4qab B:1-205 [267292]
   Other proteins in same PDB: d4qaba2, d4qabb2, d4qabc2, d4qabd2, d4qabe2, d4qabf2, d4qabg2, d4qabh2, d4qabi2, d4qabj2
   automated match to d4alxa_
   complexed with kk2, nag, po4

Details for d4qabb1

PDB Entry: 4qab, 2.98 Å

PDB Description: x-ray structure of acetylcholine binding protein (achbp) in complex with 4-(morpholin-4-yl)-6-[4-(trifluoromethyl)phenyl]pyrimidin-2- amine

PDB Compounds: (B:) acetylcholine-binding protein

SCOPe Domain Sequences for d4qabb1:

Sequence, based on SEQRES records:

>d4qabb1 b.96.1.1 (B:1-205) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkkg

Sequence, based on observed residues (ATOM records):

>d4qabb1 b.96.1.1 (B:1-205) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdptddseyfsqysrfeildvtqkknsvt
ysccpeayedvevslnfrkkg

Timeline for d4qabb1:

• d4qabb1 first appeared in SCOPe 2.05, called d4qabb_
  
• d4qabb1 appears in SCOPe 2.07
  
• d4qabb1 appears in the current release, SCOPe 2.08