SCOPe 2.06: Domain d4qaae1: 4qaa E:1-205

Lineage for d4qaae1 (4qaa E:1-205)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
   automatically mapped to Pfam PF02931

6. Protein automated matches [190922] (2 species)
   not a true protein

7. Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (31 PDB entries)

8. Domain d4qaae1: 4qaa E:1-205 [267285]
   Other proteins in same PDB: d4qaaa2, d4qaab2, d4qaac2, d4qaad2, d4qaae2, d4qaaf2, d4qaag2, d4qaah2, d4qaai2, d4qaaj2
   automated match to d4alxa_
   complexed with kk1, nag, po4

Details for d4qaae1

PDB Entry: 4qaa, 2.7 Å

PDB Description: x-ray structure of acetylcholine binding protein (achbp) in complex with 6-(4-methoxyphenyl)-n4-octylpyrimidine-2,4-diamine

PDB Compounds: (E:) acetylcholine-binding protein

SCOPe Domain Sequences for d4qaae1:

Sequence, based on SEQRES records:

>d4qaae1 b.96.1.1 (E:1-205) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkkg

Sequence, based on observed residues (ATOM records):

>d4qaae1 b.96.1.1 (E:1-205) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdptsddseyfsqysrfeildvtqkknsv
teayedvevslnfrkkg

Timeline for d4qaae1:

• d4qaae1 first appeared in SCOPe 2.05, called d4qaae_
  
• d4qaae1 appears in SCOPe 2.07
  
• d4qaae1 appears in the current release, SCOPe 2.08