Lineage for d4q9xa_ (4q9x A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2940626Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2940627Protein automated matches [190526] (26 species)
    not a true protein
  7. 2940727Species Clavularia sp. [TaxId:86521] [188532] (9 PDB entries)
  8. 2940736Domain d4q9xa_: 4q9x A: [267280]
    automated match to d4q9wa_
    complexed with cl, co3, pd

Details for d4q9xa_

PDB Entry: 4q9x (more details), 1.9 Å

PDB Description: mTFP* PdCl2 soak
PDB Compounds: (A:) GFP-like fluorescent chromoprotein cFP484

SCOPe Domain Sequences for d4q9xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q9xa_ d.22.1.0 (A:) automated matches {Clavularia sp. [TaxId: 86521]}
gvikpdmkiklkmegnvngyafviegegegkpydgtntinlevkegaplpfsydilttaf
xnraftkypddipnyfkqsfpegyswertmtfedkgivkvksdisleedsfiyeiylkge
nfppngpvmqkkttgwdastermyvrdgvlkgdvkhklllegggyyrvdfktiyrakkav
klpdyhfvdhrieilnydkdynkvtvyesavarn

SCOPe Domain Coordinates for d4q9xa_:

Click to download the PDB-style file with coordinates for d4q9xa_.
(The format of our PDB-style files is described here.)

Timeline for d4q9xa_: