| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
| Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
| Protein automated matches [190526] (26 species) not a true protein |
| Species Clavularia sp. [TaxId:86521] [188532] (9 PDB entries) |
| Domain d4q9xa_: 4q9x A: [267280] automated match to d4q9wa_ complexed with cl, co3, pd |
PDB Entry: 4q9x (more details), 1.9 Å
SCOPe Domain Sequences for d4q9xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q9xa_ d.22.1.0 (A:) automated matches {Clavularia sp. [TaxId: 86521]}
gvikpdmkiklkmegnvngyafviegegegkpydgtntinlevkegaplpfsydilttaf
xnraftkypddipnyfkqsfpegyswertmtfedkgivkvksdisleedsfiyeiylkge
nfppngpvmqkkttgwdastermyvrdgvlkgdvkhklllegggyyrvdfktiyrakkav
klpdyhfvdhrieilnydkdynkvtvyesavarn
Timeline for d4q9xa_: