Lineage for d4q80b_ (4q80 B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2390288Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2390289Protein automated matches [190438] (26 species)
    not a true protein
  7. 2390333Species Human (Homo sapiens) [TaxId:9606] [187421] (76 PDB entries)
  8. 2390439Domain d4q80b_: 4q80 B: [267273]
    automated match to d4q7za_
    complexed with 2ys, nag

Details for d4q80b_

PDB Entry: 4q80 (more details), 3.07 Å

PDB Description: neutrophil serine protease 4 (prss57) with val-leu-lys- chloromethylketone (vlk-cmk)
PDB Compounds: (B:) Serine protease 57

SCOPe Domain Sequences for d4q80b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q80b_ b.47.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iigghevtphsrpymasvrfggqhhcggfllrarwvvsaahcfshrdlrtglvvlgahvl
staeptqqvfgidaltthpdyhpmthandicllrlngsavlgpavgllrlpgrrarppta
gtrcrvagwgfvsdfeelppglmeakvrvldpdvcnsswkghltltmlctrsgdshrrgf
csadsggplvcrnrahglvsfsglwcgdpktpdvytqvsafvawiwdvvrrss

SCOPe Domain Coordinates for d4q80b_:

Click to download the PDB-style file with coordinates for d4q80b_.
(The format of our PDB-style files is described here.)

Timeline for d4q80b_: