SCOPe 2.06: Domain d4q80a_: 4q80 A:

Lineage for d4q80a_ (4q80 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.0: automated matches [191364] (1 protein)
   not a true family

6. Protein automated matches [190438] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187421] (74 PDB entries)

8. Domain d4q80a_: 4q80 A: [267272]
   automated match to d4q7za_
   complexed with 2ys, nag

Details for d4q80a_

PDB Entry: 4q80, 3.07 Å

PDB Description: neutrophil serine protease 4 (prss57) with val-leu-lys- chloromethylketone (vlk-cmk)

PDB Compounds: (A:) Serine protease 57

SCOPe Domain Sequences for d4q80a_:

Sequence; same for both SEQRES and ATOM records:

>d4q80a_ b.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iigghevtphsrpymasvrfggqhhcggfllrarwvvsaahcfshrdlrtglvvlgahvl
staeptqqvfgidaltthpdyhpmthandicllrlngsavlgpavgllrlpgrrarppta
gtrcrvagwgfvsdfeelppglmeakvrvldpdvcnsswkghltltmlctrsgdshrrgf
csadsggplvcrnrahglvsfsglwcgdpktpdvytqvsafvawiwdvvrrss

Timeline for d4q80a_:

• d4q80a_ first appeared in SCOPe 2.05
  
• d4q80a_ appears in SCOPe 2.07
  
• d4q80a_ appears in the current release, SCOPe 2.08