Lineage for d4q7xa_ (4q7x A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2390288Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2390289Protein automated matches [190438] (26 species)
    not a true protein
  7. 2390333Species Human (Homo sapiens) [TaxId:9606] [187421] (76 PDB entries)
  8. 2390405Domain d4q7xa_: 4q7x A: [267270]
    automated match to d4q7za_
    complexed with fuc, gol, nag

Details for d4q7xa_

PDB Entry: 4q7x (more details), 2.55 Å

PDB Description: neutrophil serine protease 4 (prss57) apo form 1
PDB Compounds: (A:) Serine protease 57

SCOPe Domain Sequences for d4q7xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q7xa_ b.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iigghevtphsrpymasvrfggqhhcggfllrarwvvsaahcfshrdlrtglvvlgahvl
staeptqqvfgidaltthpdyhpmthandicllrlngsavlgpavgllrlpgrrarppta
gtrcrvagwgfvsdfeelppglmeakvrvldpdvcnsswkghltltmlctrsgdshrrgf
csadsggplvcrnrahglvsfsglwcgdpktpdvytqvsafvawiwdvvrrsspq

SCOPe Domain Coordinates for d4q7xa_:

Click to download the PDB-style file with coordinates for d4q7xa_.
(The format of our PDB-style files is described here.)

Timeline for d4q7xa_: