Lineage for d4q5hc_ (4q5h C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898312Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1898313Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1898682Family d.20.1.0: automated matches [191322] (1 protein)
    not a true family
  6. 1898683Protein automated matches [190120] (6 species)
    not a true protein
  7. 1898688Species Human (Homo sapiens) [TaxId:9606] [186843] (16 PDB entries)
  8. 1898692Domain d4q5hc_: 4q5h C: [267269]
    Other proteins in same PDB: d4q5hb_
    automated match to d4q5ec_
    complexed with anp, mg

Details for d4q5hc_

PDB Entry: 4q5h (more details), 2 Å

PDB Description: shigella effector kinase ospg bound to amppnp and e2-ub ubch7-ub conjugate
PDB Compounds: (C:) Ubiquitin-conjugating enzyme E2 L3

SCOPe Domain Sequences for d4q5hc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q5hc_ d.20.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmaasrrlmkeleeirksgmknfrniqvdeanlltwqglivpdnppydkgafrieinfpa
eypfkppkitfktkiyhpnidekgqvclpvisaenwkpatktdqviqslialvndpqpeh
plradlaeeyskdrkkfsknaeeftkkygekrpvd

SCOPe Domain Coordinates for d4q5hc_:

Click to download the PDB-style file with coordinates for d4q5hc_.
(The format of our PDB-style files is described here.)

Timeline for d4q5hc_: