Lineage for d4q5hc1 (4q5h C:1-154)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2507728Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2507729Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2508149Family d.20.1.0: automated matches [191322] (1 protein)
    not a true family
  6. 2508150Protein automated matches [190120] (8 species)
    not a true protein
  7. 2508155Species Human (Homo sapiens) [TaxId:9606] [186843] (20 PDB entries)
  8. 2508172Domain d4q5hc1: 4q5h C:1-154 [267269]
    Other proteins in same PDB: d4q5hb_, d4q5hc2
    automated match to d4q5ec_
    complexed with anp, mg

Details for d4q5hc1

PDB Entry: 4q5h (more details), 2 Å

PDB Description: shigella effector kinase ospg bound to amppnp and e2-ub ubch7-ub conjugate
PDB Compounds: (C:) Ubiquitin-conjugating enzyme E2 L3

SCOPe Domain Sequences for d4q5hc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q5hc1 d.20.1.0 (C:1-154) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maasrrlmkeleeirksgmknfrniqvdeanlltwqglivpdnppydkgafrieinfpae
ypfkppkitfktkiyhpnidekgqvclpvisaenwkpatktdqviqslialvndpqpehp
lradlaeeyskdrkkfsknaeeftkkygekrpvd

SCOPe Domain Coordinates for d4q5hc1:

Click to download the PDB-style file with coordinates for d4q5hc1.
(The format of our PDB-style files is described here.)

Timeline for d4q5hc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4q5hc2
View in 3D
Domains from other chains:
(mouse over for more information)
d4q5hb_