SCOPe 2.08: Domain d4q5hc1: 4q5h C:1-154

Lineage for d4q5hc1 (4q5h C:1-154)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.0: automated matches [191322] (1 protein)
   not a true family

6. Protein automated matches [190120] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186843] (28 PDB entries)

8. Domain d4q5hc1: 4q5h C:1-154 [267269]
   Other proteins in same PDB: d4q5hb_, d4q5hc2
   automated match to d4q5ec_
   complexed with anp, mg

Details for d4q5hc1

PDB Entry: 4q5h, 2 Å

PDB Description: shigella effector kinase ospg bound to amppnp and e2-ub ubch7-ub conjugate

PDB Compounds: (C:) Ubiquitin-conjugating enzyme E2 L3

SCOPe Domain Sequences for d4q5hc1:

Sequence; same for both SEQRES and ATOM records:

>d4q5hc1 d.20.1.0 (C:1-154) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maasrrlmkeleeirksgmknfrniqvdeanlltwqglivpdnppydkgafrieinfpae
ypfkppkitfktkiyhpnidekgqvclpvisaenwkpatktdqviqslialvndpqpehp
lradlaeeyskdrkkfsknaeeftkkygekrpvd

Timeline for d4q5hc1:

• d4q5hc1 first appeared in SCOPe 2.05, called d4q5hc_
  
• d4q5hc1 appears in SCOPe 2.07