Lineage for d4q5hb_ (4q5h B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2932413Protein automated matches [190118] (16 species)
    not a true protein
  7. 2932423Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [193751] (7 PDB entries)
  8. 2932425Domain d4q5hb_: 4q5h B: [267268]
    Other proteins in same PDB: d4q5hc1, d4q5hc2
    automated match to d4q5eb_
    complexed with anp, mg

Details for d4q5hb_

PDB Entry: 4q5h (more details), 2 Å

PDB Description: shigella effector kinase ospg bound to amppnp and e2-ub ubch7-ub conjugate
PDB Compounds: (B:) Polyubiquitin

SCOPe Domain Sequences for d4q5hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q5hb_ d.15.1.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagrqledgrtlsdyn
iqkestlhlvlrlrgc

SCOPe Domain Coordinates for d4q5hb_:

Click to download the PDB-style file with coordinates for d4q5hb_.
(The format of our PDB-style files is described here.)

Timeline for d4q5hb_: