SCOPe 2.08: Domain d4q4w1_: 4q4w 1:

Lineage for d4q4w1_ (4q4w 1:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein automated matches [190854] (27 species)
   not a true protein

7. Species Coxsackievirus a24 [TaxId:12089] [260750] (4 PDB entries)

8. Domain d4q4w1_: 4q4w 1: [267266]
   automated match to d2plv1_
   complexed with ca, cl, hez

Details for d4q4w1_

PDB Entry: 4q4w, 1.4 Å

PDB Description: High-resolution crystal structure of Coxsackievirus A24v

PDB Compounds: (1:) Coxsackievirus capsid protein VP1

SCOPe Domain Sequences for d4q4w1_:

Sequence; same for both SEQRES and ATOM records:

>d4q4w1_ b.121.4.1 (1:) automated matches {Coxsackievirus a24 [TaxId: 12089]}
ptaqstpltsgvnsqevpaltavetgasgqavpsdvietrhvvnyktrsestlesffgrs
acvtilevenfnattdadrkkqfttwaitytdtvqlrrklefftysrfdlemtfvitery
yasntgharnqvyqlmyippgaprptawddytwqsssnpsvfytygsapprmsipyvgia
nayshfydgfarvplkdetvdsgdtyyglvtindfgtlavrvvneynparitskirvymk
pkhvrcwcprppravpyrgegvdfkqdsitpltavenintf

Timeline for d4q4w1_:

• d4q4w1_ first appeared in SCOPe 2.05
  
• d4q4w1_ appears in SCOPe 2.07