SCOP 1.61: Domain d1idbb_: 1idb B:

Lineage for d1idbb_ (1idb B:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)

6. Protein Human immunodeficiency virus type 2 (HIV-2) protease [50634] (1 species)

7. Species Human immunodeficiency virus type 2 [TaxId:11709] [50635] (15 PDB entries)

8. Domain d1idbb_: 1idb B: [26726]

Details for d1idbb_

PDB Entry: 1idb, 2.2 Å

PDB Description: crystal structures of hiv-2 protease in complex with inhibitors containing the hydroxyethylamine dipeptide isostere

SCOP Domain Sequences for d1idbb_:

Sequence; same for both SEQRES and ATOM records:

>d1idbb_ b.50.1.1 (B:) Human immunodeficiency virus type 2 (HIV-2) protease {Human immunodeficiency virus type 2}
pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintkeyk
nveievlnkkvratimtgdtpinifgrniltalgmslnl

Timeline for d1idbb_:

• d1idbb_ first appeared (with stable ids) in SCOP 1.55
  
• d1idbb_ appears in SCOP 1.59
  
• d1idbb_ appears in SCOP 1.63
  
• d1idbb_ appears in the current release, SCOPe 2.08