SCOP 1.63: Domain d1hiia_: 1hii A:

Lineage for d1hiia_ (1hii A:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 2 (HIV-2) protease [50634] (1 species)

7. Species Human immunodeficiency virus type 2 [TaxId:11709] [50635] (15 PDB entries)

8. Domain d1hiia_: 1hii A: [26723]

Details for d1hiia_

PDB Entry: 1hii, 2.3 Å

PDB Description: comparative analysis of the x-ray structures of hiv-1 and hiv-2 proteases in complex with cgp 53820, a novel pseudosymmetric inhibitor

SCOP Domain Sequences for d1hiia_:

Sequence; same for both SEQRES and ATOM records:

>d1hiia_ b.50.1.1 (A:) Human immunodeficiency virus type 2 (HIV-2) protease {Human immunodeficiency virus type 2}
pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintkeyk
nveievlnkkvratimtgdtpinifgrniltalgmslnl

Timeline for d1hiia_:

• d1hiia_ first appeared (with stable ids) in SCOP 1.55
  
• d1hiia_ appears in SCOP 1.61
  
• d1hiia_ appears in SCOP 1.65
  
• d1hiia_ appears in the current release, SCOPe 2.08