Lineage for d4pvdd_ (4pvd D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2094491Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [232746] (4 PDB entries)
  8. 2094500Domain d4pvdd_: 4pvd D: [267227]
    automated match to d4pvcb_
    complexed with ndp

Details for d4pvdd_

PDB Entry: 4pvd (more details), 2.4 Å

PDB Description: Crystal structure of yeast methylglyoxal/isovaleraldehyde reductase Gre2 complexed with NADPH
PDB Compounds: (D:) NADPH-dependent methylglyoxal reductase GRE2

SCOPe Domain Sequences for d4pvdd_:

Sequence, based on SEQRES records: (download)

>d4pvdd_ c.2.1.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
msvfvsgangfiaqhivdlllkedykvigsarsqekaenlteafgnnpkfsmevvpdisk
ldafdhvfqkhgkdikivlhtaspfcfditdserdllipavngvkgilhsikkyaadsve
rvvltssyaavfdmakendksltfneeswnpatwescqsdpvnaycgskkfaekaawefl
eenrdsvkfeltavnpvyvfgpqmfdkdvkkhlntscelvnslmhlspedkipelfggyi
dvrdvakahlvafqkretigqrlivsearftmqdvldilnedfpvlkgnipvgkpgsgat
hntlgatldnkkskkllgfkfrnlketiddtasqilkfegr

Sequence, based on observed residues (ATOM records): (download)

>d4pvdd_ c.2.1.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
msvfvsgangfiaqhivdlllkedykvigsarsqekaenlteafgnnpkfsmevvpdisk
ldafdhvfqkhgkdikivlhtaspllipavngvkgilhsikkyaadsvervvltssyaav
fdkendksltfnnpatskkfaekaawefleenrdsvkfeltavnpvyvfgpqmfdkdvkk
celvnslmhlspedkipelfggyidvrdvakahlvafqkretigqrlivsearftmqdvl
dilnedfpvlkgnipvgkpgsgathntlgatldnkkskkllgfkfrnlketiddtasqil
kfegr

SCOPe Domain Coordinates for d4pvdd_:

Click to download the PDB-style file with coordinates for d4pvdd_.
(The format of our PDB-style files is described here.)

Timeline for d4pvdd_: