Class b: All beta proteins [48724] (119 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (2 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein Human immunodeficiency virus type 2 (HIV-2) protease [50634] (1 species) |
Species Human immunodeficiency virus type 2 [TaxId:11709] [50635] (15 PDB entries) |
Domain d7upjb_: 7upj B: [26722] complexed with inu |
PDB Entry: 7upj (more details), 2 Å
SCOP Domain Sequences for d7upjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7upjb_ b.50.1.1 (B:) Human immunodeficiency virus type 2 (HIV-2) protease {Human immunodeficiency virus type 2} pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd qilieicghkaigtvlvgptpvniigrnlltqigctlnf
Timeline for d7upjb_: