Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (125 species) not a true protein |
Species Halothermothrix orenii [TaxId:373903] [256095] (4 PDB entries) |
Domain d4ptwa_: 4ptw A: [267216] automated match to d3ta9a_ complexed with g2f, pg4 |
PDB Entry: 4ptw (more details), 2 Å
SCOPe Domain Sequences for d4ptwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ptwa_ c.1.8.0 (A:) automated matches {Halothermothrix orenii [TaxId: 373903]} iifpedfiwgaatssyqiegafnedgkgesiwdrfshtpgkiengdtgdiacdhyhlyre dielmkeigirsyrfstswprilpegkgrvnqkgldfykrlvdnllkanirpmitlyhwd lpqalqdkggwtnrdtakyfaeyarlmfeefnglvdlwvthnepwvvafeghafgnhapg tkdfktalqvahhlllshgmavdifreedlpgeigitlnltpaypagdsekdvkaaslld dyinawflspvfkgsypeelhhiyeqnlgafttqpgdmdiisrdidflginyysrmvvrh kpgdnlfnaevvkmedrpstemgweiypqglydilvrvnkeytdkplyitengaafddkl teegkihdekrinylgdhfkqaykalkdgvplrgyyvwslmdnfewaygyskrfgliyvd yengnrrflkdsalwyreviekgqv
Timeline for d4ptwa_: