SCOPe 2.08: Domain d4psha_: 4psh A:

Lineage for d4psha_ (4psh A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [187721] (11 PDB entries)

8. Domain d4psha_: 4psh A: [267214]
   automated match to d4prsb_
   complexed with arg

Details for d4psha_

PDB Entry: 4psh, 2.6 Å

PDB Description: Structure of holo ArgBP from T. maritima

PDB Compounds: (A:) ABC-type transporter, periplasmic subunit family 3

SCOPe Domain Sequences for d4psha_:

Sequence; same for both SEQRES and ATOM records:

>d4psha_ c.94.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
ideiksrgyllvglsadfppfefvdengnivgfdvdlakeiarrlgvelkivdmtfdgli
pslltkkidviisgmtiteerkkvvafsdpyfdagqvivvrkdsdfrpktyedlvgktva
vqigttgdievskydgikvvrfdkftdaflelkrgradavvldsatarafvaknpdlvis
sgvlsseqygiavrkedtdllefinsvlrelkkspydvliekwfs

Timeline for d4psha_:

• d4psha_ first appeared in SCOPe 2.05
  
• d4psha_ appears in SCOPe 2.07