SCOPe 2.08: Domain d4prxa2: 4prx A:221-377

Lineage for d4prxa2 (4prx A:221-377)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.0: automated matches [191504] (1 protein)
   not a true family

6. Protein automated matches [190826] (23 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [255192] (4 PDB entries)

8. Domain d4prxa2: 4prx A:221-377 [267213]
   Other proteins in same PDB: d4prxa1
   automated match to d3cwvb2
   complexed with adp, gol, mg, po4

Details for d4prxa2

PDB Entry: 4prx, 1.8 Å

PDB Description: e. coli gyrb 43-kda n-terminal fragment in complex with adp+pi

PDB Compounds: (A:) GyrB

SCOPe Domain Sequences for d4prxa2:

Sequence, based on SEQRES records:

>d4prxa2 d.14.1.0 (A:221-377) automated matches {Escherichia coli [TaxId: 562]}
gikafveylnknktpihpnifyfstekdgigvevalqwndgfqeniycftnnipqrdggt
hlagfraamtrtlnaymdkegyskkakvsatgddaregliavvsvkvpdpkfssqtkdkl
vssevksaveqqmnellaeyllenptdakivvgkiid

Sequence, based on observed residues (ATOM records):

>d4prxa2 d.14.1.0 (A:221-377) automated matches {Escherichia coli [TaxId: 562]}
gikafveylnknktpihpnifyfstekdgigvevalqwndgfqeniycftnnipqrdggt
hlagfraamtrtlnaymdkegysaregliavvsvkvpdpkfssqtkdklvssevksaveq
qmnellaeyllenptdakivvgkiid

Timeline for d4prxa2:

• d4prxa2 first appeared in SCOPe 2.05
  
• d4prxa2 appears in SCOPe 2.07