Lineage for d4prva2 (4prv A:221-386)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2176343Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2176344Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2177072Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2177073Protein automated matches [190826] (17 species)
    not a true protein
  7. 2177116Species Escherichia coli [TaxId:562] [255192] (4 PDB entries)
  8. 2177120Domain d4prva2: 4prv A:221-386 [267211]
    Other proteins in same PDB: d4prva1
    automated match to d3cwvb2
    complexed with adp, mg

Details for d4prva2

PDB Entry: 4prv (more details), 2 Å

PDB Description: e. coli gyrb 43-kda n-terminal fragment in complex with adp
PDB Compounds: (A:) GyrB

SCOPe Domain Sequences for d4prva2:

Sequence, based on SEQRES records: (download)

>d4prva2 d.14.1.0 (A:221-386) automated matches {Escherichia coli [TaxId: 562]}
gikafveylnknktpihpnifyfstekdgigvevalqwndgfqeniycftnnipqrdggt
hlagfraamtrtlnaymdkegyskkakvsatgddaregliavvsvkvpdpkfssqtkdkl
vssevksaveqqmnellaeyllenptdakivvgkiidaarareaar

Sequence, based on observed residues (ATOM records): (download)

>d4prva2 d.14.1.0 (A:221-386) automated matches {Escherichia coli [TaxId: 562]}
gikafveylnknktpihpnifyfstekdgigvevalqwndgfqeniycftnnipqrdggt
hlagfraamtrtlnaymdkegyregliavvsvkvpdpkfssqtkdklvssevksaveqqm
nellaeyllenptdakivvgkiidaarareaar

SCOPe Domain Coordinates for d4prva2:

Click to download the PDB-style file with coordinates for d4prva2.
(The format of our PDB-style files is described here.)

Timeline for d4prva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4prva1