Lineage for d4prva1 (4prv A:5-220)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973995Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2973996Protein automated matches [226867] (22 species)
    not a true protein
  7. 2974025Species Escherichia coli [TaxId:562] [225182] (8 PDB entries)
  8. 2974030Domain d4prva1: 4prv A:5-220 [267210]
    Other proteins in same PDB: d4prva2
    automated match to d3cwvb1
    complexed with adp, mg

Details for d4prva1

PDB Entry: 4prv (more details), 2 Å

PDB Description: e. coli gyrb 43-kda n-terminal fragment in complex with adp
PDB Compounds: (A:) GyrB

SCOPe Domain Sequences for d4prva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4prva1 d.122.1.0 (A:5-220) automated matches {Escherichia coli [TaxId: 562]}
ydsssikvlkgldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiivtih
adnsvsvqddgrgiptgihpeegvsaaevimtvlhaggkfddnsykvsgglhgvgvsvvn
alsqklelviqregkihrqiyehgvpqaplavtgetektgtmvrfwpsletftnvtefey
eilakrlrelsflnsgvsirlrdkrdgkedhfhyeg

SCOPe Domain Coordinates for d4prva1:

Click to download the PDB-style file with coordinates for d4prva1.
(The format of our PDB-style files is described here.)

Timeline for d4prva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4prva2